| Bioactivity | [K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate) is the acetate of [K15,R16,L27]VIP(1-7)/GRF(8-27) (HY-P4195). [K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for? the human VIP1, rat VIP1, rat VIP2 receptors, respectively[1]. VIP: VASOACTIVE Intestinal Polypeptide | ||||||
| Target | VIP1 | ||||||
| Name | [K15,R16,L27]VIP(1-7)/GRF(8-27) acetate | ||||||
| Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH2 | ||||||
| Shortening | HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 | ||||||
| Formula | C142H240N44O38.xC2H4O2 | ||||||
| Molar Mass | 3171.70 (free base) | ||||||
| Appearance | 固体 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. P Gourlet, et al. Development of high affinity selective VIP1 receptor agonists. Peptides. 1997;18(10):1539-45. |
[K15,R16,L27]VIP(1-7)/GRF(8-27) acetate
CAS: F: C142H240N44O38.xC2H4O2 W: 3171.70 (free base)
VIP(1-7)/GRF(8-27) (acetate) is the acetate of VIP(1-7)/GRF(8-27) (HY-P4195). VIP(1-7)/GRF(8-27) (acetate), a VIP1 selec
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.